- Recombinant Enterobacteria phage T4 Uncharacterized 3.7 kDa protein in ndd-denB intergenic region (y16O)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1108069
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 3,687 Da
- E Coli or Yeast
- 11689
- denB.-2
- Uncharacterized 3.7 kDa protein in ndd-denB intergenic region (y16O)
Sequence
MKILNSVLIACAWWVAQVSAVVVGIHIYYEYF